PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa17g020170.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family BBR-BPC
Protein Properties Length: 291aa    MW: 32399.5 Da    PI: 10.2699
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa17g020170.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind362.77.1e-11112901301
       GAGA_bind   1 mdddgsrernkgyyepa.aslkenlglqlmssiaerdaki....rernlalsekkaavaerd.....maflqrdkalaernkalverdnkllall 85 
                     mdddg+  rn+gyyepa a++k nlglqlms+i +r++k+    r+ nl ++++++++++++     m++    +++++       +++k++++l
  Csa17g020170.1   1 MDDDGF--RNWGYYEPAaATFKGNLGLQLMSTI-DRNTKPflpgRDPNL-MIGPNGSYHHQEpppihMSY----NWINQ-------QKDKFFNML 80 
                     99**99..9*******999**************.9**************.************99999999....*****.......899****** PP

       GAGA_bind  86 lvenslasalpvgvqvlsgtksidslqq.lse...pqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskk 176
                     +v++s     p++ +vl++t+s+ s+q+ l++   +q+e+++v         +l+ e  ++++k++k+++k  +++++k+kk +k+k++++++++
  Csa17g020170.1  81 PVTTS-----PNYGNVLPETSSAPSMQMnLHHhhhHQTEENPVV--------KLEDEVVNQTNKKRKTNSKAGSGTTTKAKKPRKPKDENSNNNN 162
                     *9997.....99****************5333223333333333........2222222344455555555667777777777777777666555 PP

       GAGA_bind 177 kvkkesad...erskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkkl 268
                     ++++++++   +r+k  kks+d+v+ngvs+D+s+lPvPvC+CtGa++qCY+WG+GGWqSaCCtt+iS++PLP+stkrrgaRi+grKmSqgafkk+
  Csa17g020170.1 163 NNNNNNTNnnvSRVKPAKKSVDMVINGVSMDISGLPVPVCTCTGAPQQCYRWGCGGWQSACCTTNISMHPLPMSTKRRGARISGRKMSQGAFKKV 257
                     54444433224789********************************************************************************* PP

       GAGA_bind 269 LekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                     LekLa++G++++np+DLk+hWA+HGtnkfvtir
  Csa17g020170.1 258 LEKLASDGFNFGNPIDLKSHWARHGTNKFVTIR 290
                     ********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF062176.3E-1011290IPR010409GAGA-binding transcriptional activator
SMARTSM012262.9E-1681290IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MDDDGFRNWG YYEPAAATFK GNLGLQLMST IDRNTKPFLP GRDPNLMIGP NGSYHHQEPP  60
PIHMSYNWIN QQKDKFFNML PVTTSPNYGN VLPETSSAPS MQMNLHHHHH HQTEENPVVK  120
LEDEVVNQTN KKRKTNSKAG SGTTTKAKKP RKPKDENSNN NNNNNNNNTN NNVSRVKPAK  180
KSVDMVINGV SMDISGLPVP VCTCTGAPQQ CYRWGCGGWQ SACCTTNISM HPLPMSTKRR  240
GARISGRKMS QGAFKKVLEK LASDGFNFGN PIDLKSHWAR HGTNKFVTIR *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0069170.0AC006917.6 Genomic sequence for Arabidopsis thaliana BAC F10B6 from chromosome I, complete sequence.
GenBankAC0106570.0AC010657.3 Genomic sequence for Arabidopsis thaliana BAC T5E21 from chromosome I, complete sequence.
GenBankAY0580730.0AY058073.1 Arabidopsis thaliana At1g14680/F10B6_22 mRNA, complete cds.
GenBankAY0903050.0AY090305.1 Arabidopsis thaliana At1g14680/F10B6_22 mRNA, complete cds.
GenBankAY3805680.0AY380568.1 Arabidopsis thaliana basic pentacysteine 2 (BPC2) mRNA, complete cds.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010476533.10.0PREDICTED: protein BASIC PENTACYSTEINE2-like isoform X2
SwissprotQ9LDE21e-177BPC2_ARATH; Protein BASIC PENTACYSTEINE2
TrEMBLQ2PQR30.0Q2PQR3_9BRAS; GAGA-binding transcriptional activator
STRINGfgenesh2_kg.1__1602__AT1G14685.11e-176(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28932769
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14685.31e-169basic pentacysteine 2